U.S. based · Ships from the U.S. · Free shipping over $130 · Same-day before 2pm EST · For research use only
Back to library
HelixCore Biotech
HelixCore Biotech
Premium Research Peptides · helixcorebio.store
Certificate of Analysis

Tesamorelin 5mg

Lot TESA-2602-C

Product

Product Name
Tesamorelin 5mg
Lot Number
TESA-2602-C
Vial Size
5mg
Form
Lyophilized powder
Sequence / Formula
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Weight
5135.83 g/mol
Release Date
April 5, 2026
Storage
−20°C, protect from light

Analytical Results

TestMethodSpecificationResultStatus
IdentityESI Mass SpectrometryMatches theoretical massConfirmedPASS
PurityReverse-Phase HPLC (UV 220 nm)≥ 98.0% area99.2%PASS
EndotoxinLAL Kinetic Chromogenic< 5.0 EU/mg0.20 EU/mgPASS
AppearanceVisualWhite lyophilized powder, free of foreign matterConformsPASS

Conclusion

Lot TESA-2602-C of Tesamorelin 5mgmeets HelixCore Biotech's release specifications and is approved for distribution as a research-use-only material. This product is not for human or veterinary use.

Issued By
HelixCore Biotech QA / QC
Issue date: May 9, 2026 · Document ID: HC-COA-TESA-2602-C
RELEASEDTESA-2602-C

This certificate documents analytical testing performed on the lot identified above. Results apply to the tested lot only. HelixCore Biotech products are sold strictly for laboratory and research purposes — see the Research Use Only Policy for the full disclaimer.

Added to cart

Are you 21 or older?

This site contains research materials. By entering, you confirm you are 21+ and accept our Terms & RUO disclaimer.